SCOPe 2.07: Domain d3be1a1: 3be1 A:1-164

Lineage for d3be1a1 (3be1 A:1-164)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)

8. Domain d3be1a1: 3be1 A:1-164 [239157]
   Other proteins in same PDB: d3be1a2, d3be1a4, d3be1l1, d3be1l2
   automated match to d1n8yc1
   complexed with mes, nag

Details for d3be1a1

PDB Entry: 3be1, 2.9 Å

PDB Description: dual specific bh1 fab in complex with the extracellular domain of her2/erbb-2

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d3be1a1:

Sequence, based on SEQRES records:

>d3be1a1 c.10.2.0 (A:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelql
rslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidt

Sequence, based on observed residues (ATOM records):

>d3be1a1 c.10.2.0 (A:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdpspgglrelqlrslteilkgg
vliqrnpqlcyqdtilwkdifhknnqlaltlidt

Timeline for d3be1a1:

• d3be1a1 first appeared in SCOPe 2.04
  
• d3be1a1 appears in SCOPe 2.06
  
• d3be1a1 appears in the current release, SCOPe 2.08