Lineage for d3ax7b6 (3ax7 B:571-694)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2188936Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2188937Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2188999Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 2189000Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 2189016Domain d3ax7b6: 3ax7 B:571-694 [239115]
    Other proteins in same PDB: d3ax7a1, d3ax7a2, d3ax7a3, d3ax7a4, d3ax7a5, d3ax7b1, d3ax7b2, d3ax7b3, d3ax7b4, d3ax7b5
    complexed with bct, ca, fad, fes, gol, sal, xax

Details for d3ax7b6

PDB Entry: 3ax7 (more details), 2.34 Å

PDB Description: Bovine Xanthine Oxidase, protease cleaved form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ax7b6:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ax7b6 d.41.1.1 (B:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOPe Domain Coordinates for d3ax7b6:

Click to download the PDB-style file with coordinates for d3ax7b6.
(The format of our PDB-style files is described here.)

Timeline for d3ax7b6: