| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
| Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
| Protein automated matches [254469] (2 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries) |
| Domain d2zite5: 2zit E:726-842 [239078] Other proteins in same PDB: d2zita1, d2zita2, d2zita4, d2zitb_, d2zitc1, d2zitc2, d2zitc4, d2zitd_, d2zite1, d2zite2, d2zite4, d2zitf_ automated match to d1n0ua5 protein/RNA complex; complexed with nad |
PDB Entry: 2zit (more details), 3 Å
SCOPe Domain Sequences for d2zite5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zite5 d.58.11.0 (E:726-842) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d2zite5:
View in 3DDomains from same chain: (mouse over for more information) d2zite1, d2zite2, d2zite3, d2zite4 |