Lineage for d2zite4 (2zit E:561-725)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2177072Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2177073Protein automated matches [190826] (17 species)
    not a true protein
  7. 2177104Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255013] (5 PDB entries)
  8. 2177107Domain d2zite4: 2zit E:561-725 [239077]
    Other proteins in same PDB: d2zita1, d2zita2, d2zita3, d2zita5, d2zitb2, d2zitb3, d2zitc1, d2zitc2, d2zitc3, d2zitc5, d2zitd2, d2zitd3, d2zite1, d2zite2, d2zite3, d2zite5, d2zitf2, d2zitf3
    automated match to d1n0ua3
    protein/RNA complex; complexed with nad

Details for d2zite4

PDB Entry: 2zit (more details), 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d2zite4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zite4 d.14.1.0 (E:561-725) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d2zite4:

Click to download the PDB-style file with coordinates for d2zite4.
(The format of our PDB-style files is described here.)

Timeline for d2zite4: