Lineage for d2zite2 (2zit E:344-481)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402871Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2402872Protein automated matches [226946] (29 species)
    not a true protein
  7. 2402888Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)
  8. 2402897Domain d2zite2: 2zit E:344-481 [239075]
    Other proteins in same PDB: d2zita1, d2zita3, d2zita4, d2zita5, d2zitb2, d2zitb3, d2zitc1, d2zitc3, d2zitc4, d2zitc5, d2zitd2, d2zitd3, d2zite1, d2zite3, d2zite4, d2zite5, d2zitf2, d2zitf3
    automated match to d1n0ua1
    protein/RNA complex; complexed with nad

Details for d2zite2

PDB Entry: 2zit (more details), 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d2zite2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zite2 b.43.3.0 (E:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d2zite2:

Click to download the PDB-style file with coordinates for d2zite2.
(The format of our PDB-style files is described here.)

Timeline for d2zite2: