Lineage for d2zitc2 (2zit C:344-481)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544344Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1544345Protein automated matches [226946] (16 species)
    not a true protein
  7. 1544356Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)
  8. 1544358Domain d2zitc2: 2zit C:344-481 [239070]
    Other proteins in same PDB: d2zita1, d2zita3, d2zita4, d2zita5, d2zitb_, d2zitc1, d2zitc3, d2zitc4, d2zitc5, d2zitd_, d2zite1, d2zite3, d2zite4, d2zite5, d2zitf_
    automated match to d1n0ua1
    protein/RNA complex; complexed with nad

Details for d2zitc2

PDB Entry: 2zit (more details), 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d2zitc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zitc2 b.43.3.0 (C:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d2zitc2:

Click to download the PDB-style file with coordinates for d2zitc2.
(The format of our PDB-style files is described here.)

Timeline for d2zitc2: