Lineage for d2zgtb_ (2zgt B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534620Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1534621Protein automated matches [190437] (29 species)
    not a true protein
  7. 1534622Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)
  8. 1534656Domain d2zgtb_: 2zgt B: [239055]
    automated match to d2zgta_
    mutant

Details for d2zgtb_

PDB Entry: 2zgt (more details), 2.8 Å

PDB Description: crystal structure of agrocybe aegerita lectin aal mutant f93g
PDB Compounds: (B:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgtb_:

Sequence, based on SEQRES records: (download)

>d2zgtb_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllhi
afrlqenviifnsrqpdgpwlveqrvsdvanqgagidgkamvtvfdhgdkyqvvinektv
iqytkqisgltsslsynateetsifstvveavtytglale

Sequence, based on observed residues (ATOM records): (download)

>d2zgtb_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
qgvniynisagtsvdlaapvttgdivtffssalnttlnlfaengayllhiafrlqenvii
fnsrqpdgpwlveqrvsdvagagidgkamvtvfdhgdkyqvvinektviqytkqisglts
slsynattvveavtytglale

SCOPe Domain Coordinates for d2zgtb_:

Click to download the PDB-style file with coordinates for d2zgtb_.
(The format of our PDB-style files is described here.)

Timeline for d2zgtb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zgta_