SCOPe 2.06: Domain d2zgsb_: 2zgs B:

Lineage for d2zgsb_ (2zgs B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d2zgsb_: 2zgs B: [239054]
   automated match to d2zgsa_
   mutant

Details for d2zgsb_

PDB Entry: 2zgs, 1.9 Å

PDB Description: crystal structure of agrocybe aegerita lectin aal mutant l47a

PDB Compounds: (B:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgsb_:

Sequence; same for both SEQRES and ATOM records:

>d2zgsb_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttanlfaengayllhi
afrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv
iqytkqisgltsslsynateetsifstvveavtytgla

Timeline for d2zgsb_:

• d2zgsb_ first appeared in SCOPe 2.04
  
• d2zgsb_ appears in SCOPe 2.05
  
• d2zgsb_ appears in SCOPe 2.07
  
• d2zgsb_ appears in the current release, SCOPe 2.08