SCOPe 2.06: Domain d2x3eb2: 2x3e B:176-327

Lineage for d2x3eb2 (2x3e B:176-327)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [231543] (2 PDB entries)

8. Domain d2x3eb2: 2x3e B:176-327 [238992]

Details for d2x3eb2

PDB Entry: 2x3e, 1.81 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl carrier protein) synthase iii, fabh from pseudomonas aeruginosa pao1

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2x3eb2:

Sequence, based on SEQRES records:

>d2x3eb2 c.95.1.0 (B:176-327) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
llafdlgsdghqfdllmtpavsraerssgqasnyfrmdgkavfgqavtqmsdsvrrvldr
vgwqasdlhhlvphqantrilaavadqldlpvervvsniaevgntvaasiplalahglrq
gilrdggnmvltgfgagltwgsvalrwpkivp

Sequence, based on observed residues (ATOM records):

>d2x3eb2 c.95.1.0 (B:176-327) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
llafdlgsdghqfdllmtpavsranyfrmdgkavfgqavtqmsdsvrrvldrvgwqasdl
hhlvphqantrilaavadqldlpvervvsniaevgntvaasiplalahglrqgilrdggn
mvltgfgagltwgsvalrwpkivp

Timeline for d2x3eb2:

• d2x3eb2 first appeared in SCOPe 2.04
  
• d2x3eb2 appears in SCOPe 2.05
  
• d2x3eb2 appears in SCOPe 2.07
  
• d2x3eb2 appears in the current release, SCOPe 2.08