Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [231543] (2 PDB entries) |
Domain d2x3eb2: 2x3e B:176-327 [238992] |
PDB Entry: 2x3e (more details), 1.81 Å
SCOPe Domain Sequences for d2x3eb2:
Sequence, based on SEQRES records: (download)
>d2x3eb2 c.95.1.0 (B:176-327) automated matches {Pseudomonas aeruginosa [TaxId: 287]} llafdlgsdghqfdllmtpavsraerssgqasnyfrmdgkavfgqavtqmsdsvrrvldr vgwqasdlhhlvphqantrilaavadqldlpvervvsniaevgntvaasiplalahglrq gilrdggnmvltgfgagltwgsvalrwpkivp
>d2x3eb2 c.95.1.0 (B:176-327) automated matches {Pseudomonas aeruginosa [TaxId: 287]} llafdlgsdghqfdllmtpavsranyfrmdgkavfgqavtqmsdsvrrvldrvgwqasdl hhlvphqantrilaavadqldlpvervvsniaevgntvaasiplalahglrqgilrdggn mvltgfgagltwgsvalrwpkivp
Timeline for d2x3eb2: