Lineage for d1cb8a2 (1cb8 A:600-700)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12324Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
  4. 12325Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 12326Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (2 proteins)
  6. 12327Protein Chondroitinase AC [49865] (1 species)
  7. 12328Species Flavobacterium heparinum [TaxId:984] [49866] (1 PDB entry)
  8. 12329Domain d1cb8a2: 1cb8 A:600-700 [23898]
    Other proteins in same PDB: d1cb8a1, d1cb8a3

Details for d1cb8a2

PDB Entry: 1cb8 (more details), 1.9 Å

PDB Description: chondroitinase ac lyase from flavobacterium heparinum

SCOP Domain Sequences for d1cb8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb8a2 b.24.1.1 (A:600-700) Chondroitinase AC {Flavobacterium heparinum}
pkvlantnqlqavyhqqldmvqaifytagklsvagieietdkpcavlikhingkqviwaa
dplqkektavlsirdlktgktnrvkidfpqqefagatvelk

SCOP Domain Coordinates for d1cb8a2:

Click to download the PDB-style file with coordinates for d1cb8a2.
(The format of our PDB-style files is described here.)

Timeline for d1cb8a2: