Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein automated matches [231469] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [231470] (2 PDB entries) |
Domain d2wp9j2: 2wp9 J:107-238 [238977] Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9a3, d2wp9b1, d2wp9c_, d2wp9d_, d2wp9e1, d2wp9e2, d2wp9e3, d2wp9f1, d2wp9g_, d2wp9h_, d2wp9i1, d2wp9i2, d2wp9i3, d2wp9j1, d2wp9k_, d2wp9l_ automated match to d2wp9b2 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wp9 (more details), 2.7 Å
SCOPe Domain Sequences for d2wp9j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wp9j2 a.1.2.1 (J:107-238) automated matches {Escherichia coli [TaxId: 562]} mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp dkfigpagllaayrflidsrdtetdsrldglsdafsvfrctsimncvsvcpkglnptrai ghiksmllqrna
Timeline for d2wp9j2: