SCOPe 2.06: Domain d2wp9j2: 2wp9 J:107-238

Lineage for d2wp9j2 (2wp9 J:107-238)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein automated matches [231469] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [231470] (2 PDB entries)

8. Domain d2wp9j2: 2wp9 J:107-238 [238977]
   Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9a3, d2wp9b1, d2wp9c_, d2wp9d_, d2wp9e1, d2wp9e2, d2wp9e3, d2wp9f1, d2wp9g_, d2wp9h_, d2wp9i1, d2wp9i2, d2wp9i3, d2wp9j1, d2wp9k_, d2wp9l_
   automated match to d2wp9b2
   complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wp9j2

PDB Entry: 2wp9, 2.7 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant

PDB Compounds: (J:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wp9j2:

Sequence; same for both SEQRES and ATOM records:

>d2wp9j2 a.1.2.1 (J:107-238) automated matches {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrctsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d2wp9j2:

• d2wp9j2 first appeared in SCOPe 2.04
  
• d2wp9j2 appears in SCOPe 2.05
  
• d2wp9j2 appears in SCOPe 2.07
  
• d2wp9j2 appears in the current release, SCOPe 2.08