SCOPe 2.05: Domain d2wkvd2: 2wkv D:269-392

Lineage for d2wkvd2 (2wkv D:269-392)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (52 species)
   not a true protein

7. Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries)

8. Domain d2wkvd2: 2wkv D:269-392 [238965]
   Other proteins in same PDB: d2wkva1, d2wkvb1, d2wkvc1, d2wkvd1
   automated match to d2wkva2
   complexed with coa, na, so4; mutant

Details for d2wkvd2

PDB Entry: 2wkv, 2.5 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the n316d mutant with coenzyme a.

PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wkvd2:

Sequence; same for both SEQRES and ATOM records:

>d2wkvd2 c.95.1.0 (D:269-392) automated matches {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveadeafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

Timeline for d2wkvd2:

• d2wkvd2 first appeared in SCOPe 2.04
  
• d2wkvd2 appears in SCOPe 2.06
  
• d2wkvd2 appears in the current release, SCOPe 2.08