SCOPe 2.06: Domain d2wktd1: 2wkt D:4-268

Lineage for d2wktd1 (2wkt D:4-268)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (10 proteins)

6. Protein automated matches [231410] (2 species)
   not a true protein

7. Species Zoogloea ramigera [TaxId:350] [231411] (6 PDB entries)

8. Domain d2wktd1: 2wkt D:4-268 [238954]
   Other proteins in same PDB: d2wkta2, d2wktb2, d2wktc2, d2wktd2
   automated match to d2wkta1
   complexed with cl, coa, k, na, so4; mutant

Details for d2wktd1

PDB Entry: 2wkt, 2 Å

PDB Description: biosynthetic thiolase from z. ramigera. complex of the n316a mutant with coenzyme a.

PDB Compounds: (D:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d2wktd1:

Sequence; same for both SEQRES and ATOM records:

>d2wktd1 c.95.1.1 (D:4-268) automated matches {Zoogloea ramigera [TaxId: 350]}
siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
gnasglndgaaaallmseaeasrrg

Timeline for d2wktd1:

• d2wktd1 first appeared in SCOPe 2.04
  
• d2wktd1 appears in SCOPe 2.05
  
• d2wktd1 appears in SCOPe 2.07
  
• d2wktd1 appears in the current release, SCOPe 2.08