Lineage for d2wgfe1 (2wgf E:2-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917865Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries)
  8. 2917902Domain d2wgfe1: 2wgf E:2-259 [238942]
    automated match to d2wgfa1
    complexed with na, peg, pg4

Details for d2wgfe1

PDB Entry: 2wgf (more details), 2.15 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis C171Q KasA variant
PDB Compounds: (E:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d2wgfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgfe1 c.95.1.0 (E:2-259) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
agalmlieteehakarga

SCOPe Domain Coordinates for d2wgfe1:

Click to download the PDB-style file with coordinates for d2wgfe1.
(The format of our PDB-style files is described here.)

Timeline for d2wgfe1: