Lineage for d2w2db2 (2w2d B:548-872)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2268037Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2268051Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 2268052Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 2268053Protein Botulinum neurotoxin [58093] (2 species)
  7. 2268054Species Clostridium botulinum, serotype A [TaxId:1491] [58094] (3 PDB entries)
  8. 2268055Domain d2w2db2: 2w2d B:548-872 [238894]
    Other proteins in same PDB: d2w2db1, d2w2db3, d2w2dd1, d2w2dd3
    complexed with act, cl, gol, so4, zn

Details for d2w2db2

PDB Entry: 2w2d (more details), 2.59 Å

PDB Description: Crystal Structure of a Catalytically Active, Non-toxic Endopeptidase Derivative of Clostridium botulinum Toxin A
PDB Compounds: (B:) botulinum neurotoxin a heavy chain

SCOPe Domain Sequences for d2w2db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w2db2 h.4.2.1 (B:548-872) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
ytmfhylraqefehgksrialtnsvneallnpsrvytffssdyvkkvnkateaamflgwv
eqlvydftdetsevsttdkiaditiiipyigpalnignmlykddfvgalifsgavillef
ipeiaipvlgtfalvsyiankvltvqtidnalskrnekwdevykyivtnwlakvntqidl
irkkmkealenqaeatkaiinyqynqyteeeknninfniddlssklnesinkamininkf
lnqcsvsylmnsmipygvkrledfdaslkdallkyiydnrgtligqvdrlkdkvnntlst
dipfqlskyvdnqrllstfteyikn

SCOPe Domain Coordinates for d2w2db2:

Click to download the PDB-style file with coordinates for d2w2db2.
(The format of our PDB-style files is described here.)

Timeline for d2w2db2: