SCOPe 2.06: Domain d2v7qb1: 2v7q B:24-94

Lineage for d2v7qb1 (2v7q B:24-94)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)

8. Domain d2v7qb1: 2v7q B:24-94 [238879]
   Other proteins in same PDB: d2v7qa2, d2v7qa3, d2v7qb2, d2v7qb3, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_
   automated match to d1maba2
   complexed with adp, atp, mg, po4

Details for d2v7qb1

PDB Entry: 2v7q, 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.

PDB Compounds: (B:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2v7qb1:

Sequence; same for both SEQRES and ATOM records:

>d2v7qb1 b.49.1.0 (B:24-94) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d2v7qb1:

• d2v7qb1 first appeared in SCOPe 2.04
  
• d2v7qb1 appears in SCOPe 2.05
  
• d2v7qb1 appears in SCOPe 2.07
  
• d2v7qb1 appears in the current release, SCOPe 2.08