Lineage for d1d0gd_ (1d0g D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12261Fold b.22: TNF-like [49841] (1 superfamily)
  4. 12262Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 12263Family b.22.1.1: TNF-like [49843] (4 proteins)
  6. 12269Protein Apoptosis-2 ligand, apo2l/TRAIL [49851] (1 species)
  7. 12270Species Human (Homo sapiens) [TaxId:9606] [49852] (5 PDB entries)
  8. 12275Domain d1d0gd_: 1d0g D: [23887]
    Other proteins in same PDB: d1d0gr1, d1d0gr2, d1d0gr3, d1d0gs1, d1d0gs2, d1d0gs3, d1d0gt1, d1d0gt2, d1d0gt3

Details for d1d0gd_

PDB Entry: 1d0g (more details), 2.4 Å

PDB Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail
PDB Compounds: (D:)

SCOP Domain Sequences for d1d0gd_:

Sequence, based on SEQRES records: (download)

>d1d0gd_ b.22.1.1 (D:) Apoptosis-2 ligand, apo2l/TRAIL {Human (Homo sapiens)}
pqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihe
kgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyg
lysiyqggifelkendrifvsvtnehlidmdheasffgaflvg

Sequence, based on observed residues (ATOM records): (download)

>d1d0gd_ b.22.1.1 (D:) Apoptosis-2 ligand, apo2l/TRAIL {Human (Homo sapiens)}
pqrvaahitgtrgekalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqtyf
rfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggifel
kendrifvsvtnehlidmdheasffgaflvg

SCOP Domain Coordinates for d1d0gd_:

Click to download the PDB-style file with coordinates for d1d0gd_.
(The format of our PDB-style files is described here.)

Timeline for d1d0gd_: