Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (16 species) not a true protein |
Species Spirulina sp. [TaxId:1157] [255593] (1 PDB entry) |
Domain d2uumf_: 2uum F: [238861] Other proteins in same PDB: d2uuma_, d2uumc_, d2uume_, d2uumg_, d2uumi_, d2uumk_, d2uumm_, d2uumo_, d2uumq_, d2uums_, d2uumu_, d2uumw_ automated match to d1ha7b_ complexed with bla, cyc |
PDB Entry: 2uum (more details), 3 Å
SCOPe Domain Sequences for d2uumf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uumf_ a.1.1.3 (F:) automated matches {Spirulina sp. [TaxId: 1157]} mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
Timeline for d2uumf_: