Lineage for d2rdxg2 (2rdx G:128-369)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1574148Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries)
  8. 1574162Domain d2rdxg2: 2rdx G:128-369 [238855]
    Other proteins in same PDB: d2rdxa1, d2rdxb1, d2rdxc1, d2rdxd1, d2rdxe1, d2rdxf1, d2rdxg1, d2rdxh1
    automated match to d2rdxe2
    complexed with gol, mg

Details for d2rdxg2

PDB Entry: 2rdx (more details), 2 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
PDB Compounds: (G:) Mandelate racemase/muconate lactonizing enzyme, putative

SCOPe Domain Sequences for d2rdxg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdxg2 c.1.11.0 (G:128-369) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
klcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidriraclpllepg
ekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmkldecvtgl
hmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggeiasaavahf
aastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnslgapvadwa
lp

SCOPe Domain Coordinates for d2rdxg2:

Click to download the PDB-style file with coordinates for d2rdxg2.
(The format of our PDB-style files is described here.)

Timeline for d2rdxg2: