SCOPe 2.04: Domain d2r29l2: 2r29 L:1-111

Lineage for d2r29l2 (2r29 L:1-111)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d2r29l2: 2r29 L:1-111 [238842]
   Other proteins in same PDB: d2r29a_, d2r29l1
   automated match to d1c12a1
   protein/RNA complex

Details for d2r29l2

PDB Entry: 2r29, 3 Å

PDB Description: neutralization of dengue virus by a serotype cross-reactive antibody elucidated by cryoelectron microscopy and x-ray crystallography

PDB Compounds: (L:) Light chain of Fab 1A1D-2

SCOPe Domain Sequences for d2r29l2:

Sequence; same for both SEQRES and ATOM records:

>d2r29l2 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvvrygnsfmhwyqqkpgqppklliyrassles
giptrfsgsgsrtdftltinpveaddvatyycqqtnvdpwafgggtkleik

Timeline for d2r29l2:

• d2r29l2 is new in SCOPe 2.04-stable
  
• d2r29l2 appears in SCOPe 2.05
  
• d2r29l2 appears in the current release, SCOPe 2.08