Class g: Small proteins [56992] (100 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein BMP receptor Ia ectodomain [57359] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries) |
Domain d2qjbd_: 2qjb D: [238831] Other proteins in same PDB: d2qjba_, d2qjbb_ automated match to d3qb4d_ complexed with cl |
PDB Entry: 2qjb (more details), 2.5 Å
SCOPe Domain Sequences for d2qjbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjbd_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} tlpflkcycshhcpedainntcitnghcftmieeddqgettltsgclglegsdfqcrdtp iphqrrsieccrtnlcnqylqptlppvvig
Timeline for d2qjbd_: