Lineage for d2qjbc_ (2qjb C:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702357Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1702358Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 1702359Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 1702370Domain d2qjbc_: 2qjb C: [238830]
    Other proteins in same PDB: d2qjba_, d2qjbb_
    automated match to d3qb4d_
    complexed with cl

Details for d2qjbc_

PDB Entry: 2qjb (more details), 2.5 Å

PDB Description: crystal structure analysis of bmp-2 in complex with bmpr-ia variant ia/ib
PDB Compounds: (C:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2qjbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjbc_ g.7.1.3 (C:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycshhcpedainntcitnghcftmieeddqgettltsgclglegsdfqcrdtp
iphqrrsieccrtnlcnqylqptlp

SCOPe Domain Coordinates for d2qjbc_:

Click to download the PDB-style file with coordinates for d2qjbc_.
(The format of our PDB-style files is described here.)

Timeline for d2qjbc_: