Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (13 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [187345] (2 PDB entries) |
Domain d2pukc_: 2puk C: [238816] Other proteins in same PDB: d2puka_, d2pukb_, d2puke2, d2puke3, d2pukf_ automated match to d1dbya_ complexed with sf4 |
PDB Entry: 2puk (more details), 3 Å
SCOPe Domain Sequences for d2pukc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pukc_ c.47.1.1 (C:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} evqdvndsswkefvlesevpvmvdfwapwcgpskliapvidelakeysgkiavyklntde apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyls
Timeline for d2pukc_: