Lineage for d2pnzb2 (2pnz B:188-274)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663587Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 1663588Protein automated matches [226956] (5 species)
    not a true protein
  7. 1663605Species Pyrococcus abyssi [TaxId:29292] [225428] (4 PDB entries)
  8. 1663609Domain d2pnzb2: 2pnz B:188-274 [238805]
    Other proteins in same PDB: d2pnza1, d2pnzb1
    automated match to d2wnra2
    complexed with 5gp, mpd, udp

Details for d2pnzb2

PDB Entry: 2pnz (more details), 2.14 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with UDP and GMP
PDB Compounds: (B:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2pnzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnzb2 d.101.1.0 (B:188-274) automated matches {Pyrococcus abyssi [TaxId: 29292]}
pvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqkseggafkleev
myavetafkkaeeirklileavekakq

SCOPe Domain Coordinates for d2pnzb2:

Click to download the PDB-style file with coordinates for d2pnzb2.
(The format of our PDB-style files is described here.)

Timeline for d2pnzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pnzb1