SCOPe 2.05: Domain d2pnzb1: 2pnz B:8-187

Lineage for d2pnzb1 (2pnz B:8-187)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225427] (4 PDB entries)

8. Domain d2pnzb1: 2pnz B:8-187 [238804]
   Other proteins in same PDB: d2pnza2, d2pnzb2
   automated match to d2wnra1
   complexed with 5gp, mpd, udp

Details for d2pnzb1

PDB Entry: 2pnz, 2.14 Å

PDB Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with UDP and GMP

PDB Compounds: (B:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2pnzb1:

Sequence; same for both SEQRES and ATOM records:

>d2pnzb1 d.14.1.0 (B:8-187) automated matches {Pyrococcus abyssi [TaxId: 29292]}
agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl
gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi
vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl

Timeline for d2pnzb1:

• d2pnzb1 first appeared in SCOPe 2.04
  
• d2pnzb1 appears in SCOPe 2.06
  
• d2pnzb1 appears in the current release, SCOPe 2.08