Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [231148] (1 PDB entry) |
Domain d2pgwg2: 2pgw G:132-375 [238799] Other proteins in same PDB: d2pgwa1, d2pgwb1, d2pgwc1, d2pgwd1, d2pgwe1, d2pgwf1, d2pgwg1, d2pgwh1 automated match to d2pgwb2 complexed with gol |
PDB Entry: 2pgw (more details), 1.95 Å
SCOPe Domain Sequences for d2pgwg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pgwg2 c.1.11.0 (G:132-375) automated matches {Sinorhizobium meliloti [TaxId: 266834]} ahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaavrgeigda rlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgipivadqaaf tlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssfttgittcaeh higlaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaedlvaegegr yaas
Timeline for d2pgwg2: