Lineage for d2or8b_ (2or8 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766990Domain d2or8b_: 2or8 B: [238783]
    automated match to d2or8a_
    complexed with act

Details for d2or8b_

PDB Entry: 2or8 (more details), 2.5 Å

PDB Description: Tim-1
PDB Compounds: (B:) Hepatitis A virus cellular receptor 1 homolog

SCOPe Domain Sequences for d2or8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2or8b_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdsyvevkgvvghpvtlpctystyrgitttcwgrgqcpssacqntliwtnghrvtyqkss
rynlkghisegdvsltiensvesdsglyccrveipgwfndqkvtfslqvkpelvpr

SCOPe Domain Coordinates for d2or8b_:

Click to download the PDB-style file with coordinates for d2or8b_.
(The format of our PDB-style files is described here.)

Timeline for d2or8b_: