SCOPe 2.05: Domain d2oqhb2: 2oqh B:123-376

Lineage for d2oqhb2 (2oqh B:123-376)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [231096] (3 PDB entries)

8. Domain d2oqhb2: 2oqh B:123-376 [238780]
   Other proteins in same PDB: d2oqha1, d2oqhb1, d2oqhc1, d2oqhd1
   automated match to d2oqha2
   complexed with so4

Details for d2oqhb2

PDB Entry: 2oqh, 1.98 Å

PDB Description: crystal structure of an isomerase from streptomyces coelicolor a3(2)

PDB Compounds: (B:) Putative isomerase

SCOPe Domain Sequences for d2oqhb2:

Sequence; same for both SEQRES and ATOM records:

>d2oqhb2 c.1.11.0 (B:123-376) automated matches {Streptomyces coelicolor [TaxId: 100226]}
avrdevpitalitradapgatpadlpkamaehavrvveeggfdavklkgttdcagdvail
ravrealpgvnlrvdpnaawsvpdsvragialeeldleyledpcvgiegmaqvkakvrip
lctnmcvvrfedfapamrlnavdvihgdvykwggiaatkalaahcetfglgmnlhsggel
giataahlavvsstpvlsraidsmyylhaddiieplhlengrlrvpsgpglgvsvdedkl
rhyagvnerdgdlt

Timeline for d2oqhb2:

• d2oqhb2 first appeared in SCOPe 2.04
  
• d2oqhb2 appears in SCOPe 2.06
  
• d2oqhb2 appears in the current release, SCOPe 2.08