Lineage for d2oqhb1 (2oqh B:4-122)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192205Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries)
  8. 2192207Domain d2oqhb1: 2oqh B:4-122 [238779]
    Other proteins in same PDB: d2oqha2, d2oqha3, d2oqhb2, d2oqhb3, d2oqhc2, d2oqhc3, d2oqhd2, d2oqhd3
    automated match to d2oqha1
    complexed with so4

Details for d2oqhb1

PDB Entry: 2oqh (more details), 1.98 Å

PDB Description: crystal structure of an isomerase from streptomyces coelicolor a3(2)
PDB Compounds: (B:) Putative isomerase

SCOPe Domain Sequences for d2oqhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqhb1 d.54.1.0 (B:4-122) automated matches {Streptomyces coelicolor [TaxId: 100226]}
kitdvdvwvvnlplvnpftssfetktgetrtvvrvrtdsgvegwgetmwgapvaaivrrm
apdligtspfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllgg

SCOPe Domain Coordinates for d2oqhb1:

Click to download the PDB-style file with coordinates for d2oqhb1.
(The format of our PDB-style files is described here.)

Timeline for d2oqhb1: