Lineage for d2k3sa_ (2k3s A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491007Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1491008Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1491085Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1491086Protein automated matches [226856] (2 species)
    not a true protein
  7. 1491141Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries)
  8. 1491144Domain d2k3sa_: 2k3s A: [238762]
    Other proteins in same PDB: d2k3sb1
    automated match to d1bhdb_

Details for d2k3sa_

PDB Entry: 2k3s (more details)

PDB Description: HADDOCK-derived structure of the CH-domain of the smoothelin-like 1 complexed with the C-domain of apocalmodulin
PDB Compounds: (A:) Smoothelin-like protein 1

SCOPe Domain Sequences for d2k3sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k3sa_ a.40.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgsknmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakr
rhnftlafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk

SCOPe Domain Coordinates for d2k3sa_:

Click to download the PDB-style file with coordinates for d2k3sa_.
(The format of our PDB-style files is described here.)

Timeline for d2k3sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2k3sb1