Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (9 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255271] (5 PDB entries) |
Domain d2jj2j2: 2jj2 J:95-379 [238756] Other proteins in same PDB: d2jj2a1, d2jj2a3, d2jj2b1, d2jj2b3, d2jj2c1, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h3, d2jj2i1, d2jj2i3, d2jj2j1, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_ automated match to d1maba3 complexed with adp, anp, azi, gol, mg, po4, que |
PDB Entry: 2jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d2jj2j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj2j2 c.37.1.11 (J:95-379) automated matches {Cow (Bos taurus) [TaxId: 9913]} vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d2jj2j2:
View in 3D Domains from other chains: (mouse over for more information) d2jj2a1, d2jj2a2, d2jj2a3, d2jj2b1, d2jj2b2, d2jj2b3, d2jj2c1, d2jj2c2, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h2, d2jj2h3, d2jj2i1, d2jj2i2, d2jj2i3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_ |