Lineage for d2jj2i3 (2jj2 I:380-509)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739159Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1739160Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1739288Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1739289Protein automated matches [254528] (7 species)
    not a true protein
  7. 1739345Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries)
  8. 1739359Domain d2jj2i3: 2jj2 I:380-509 [238754]
    Other proteins in same PDB: d2jj2a1, d2jj2a2, d2jj2b1, d2jj2b2, d2jj2c1, d2jj2c2, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h2, d2jj2i1, d2jj2i2, d2jj2j1, d2jj2j2, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_
    automated match to d1maba1
    complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2i3

PDB Entry: 2jj2 (more details), 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.
PDB Compounds: (I:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj2i3:

Sequence, based on SEQRES records: (download)

>d2jj2i3 a.69.1.0 (I:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfe

Sequence, based on observed residues (ATOM records): (download)

>d2jj2i3 a.69.1.0 (I:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklkeivtnflag
fe

SCOPe Domain Coordinates for d2jj2i3:

Click to download the PDB-style file with coordinates for d2jj2i3.
(The format of our PDB-style files is described here.)

Timeline for d2jj2i3: