SCOPe 2.05: Domain d2jj2c1: 2jj2 C:16-94

Lineage for d2jj2c1 (2jj2 C:16-94)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)

8. Domain d2jj2c1: 2jj2 C:16-94 [238746]
   Other proteins in same PDB: d2jj2a2, d2jj2a3, d2jj2b2, d2jj2b3, d2jj2c2, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h2, d2jj2h3, d2jj2i2, d2jj2i3, d2jj2j2, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_
   automated match to d1maba2
   complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2c1

PDB Entry: 2jj2, 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.

PDB Compounds: (C:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj2c1:

Sequence; same for both SEQRES and ATOM records:

>d2jj2c1 b.49.1.0 (C:16-94) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvv
fgndklikegdivkrtgai

Timeline for d2jj2c1:

• d2jj2c1 first appeared in SCOPe 2.04
  
• d2jj2c1 appears in SCOPe 2.06
  
• d2jj2c1 appears in the current release, SCOPe 2.08