Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries) |
Domain d2jj2c1: 2jj2 C:16-94 [238746] Other proteins in same PDB: d2jj2a2, d2jj2a3, d2jj2b2, d2jj2b3, d2jj2c2, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h2, d2jj2h3, d2jj2i2, d2jj2i3, d2jj2j2, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_ automated match to d1maba2 complexed with adp, anp, azi, gol, mg, po4, que |
PDB Entry: 2jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d2jj2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj2c1 b.49.1.0 (C:16-94) automated matches {Cow (Bos taurus) [TaxId: 9913]} ilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvv fgndklikegdivkrtgai
Timeline for d2jj2c1:
View in 3D Domains from other chains: (mouse over for more information) d2jj2a1, d2jj2a2, d2jj2a3, d2jj2b1, d2jj2b2, d2jj2b3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h2, d2jj2h3, d2jj2i1, d2jj2i2, d2jj2i3, d2jj2j1, d2jj2j2, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_ |