SCOPe 2.06: Domain d2jj1a1: 2jj1 A:24-94

Lineage for d2jj1a1 (2jj1 A:24-94)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255270] (6 PDB entries)

8. Domain d2jj1a1: 2jj1 A:24-94 [238722]
   Other proteins in same PDB: d2jj1a2, d2jj1a3, d2jj1b2, d2jj1b3, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h2, d2jj1h3, d2jj1i2, d2jj1i3, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_
   automated match to d1maba2
   complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1a1

PDB Entry: 2jj1, 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.

PDB Compounds: (A:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jj1a1:

Sequence; same for both SEQRES and ATOM records:

>d2jj1a1 b.49.1.0 (A:24-94) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d2jj1a1:

• d2jj1a1 first appeared in SCOPe 2.04
  
• d2jj1a1 appears in SCOPe 2.05
  
• d2jj1a1 appears in SCOPe 2.07
  
• d2jj1a1 appears in the current release, SCOPe 2.08