Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (6 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255270] (5 PDB entries) |
Domain d2jizj1: 2jiz J:16-94 [238719] Other proteins in same PDB: d2jiza2, d2jiza3, d2jizb2, d2jizb3, d2jizc2, d2jizc3, d2jizd1, d2jizd2, d2jizd3, d2jize1, d2jize2, d2jize3, d2jizf1, d2jizf2, d2jizf3, d2jizg_, d2jizh2, d2jizh3, d2jizi2, d2jizi3, d2jizj2, d2jizj3, d2jizk1, d2jizk2, d2jizk3, d2jizl1, d2jizl2, d2jizl3, d2jizm1, d2jizm2, d2jizm3, d2jizn_ automated match to d1maba2 complexed with adp, anp, azi, gol, mg, po4, stl |
PDB Entry: 2jiz (more details), 2.3 Å
SCOPe Domain Sequences for d2jizj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jizj1 b.49.1.0 (J:16-94) automated matches {Cow (Bos taurus) [TaxId: 9913]} ilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvv fgndklikegdivkrtgai
Timeline for d2jizj1:
View in 3D Domains from other chains: (mouse over for more information) d2jiza1, d2jiza2, d2jiza3, d2jizb1, d2jizb2, d2jizb3, d2jizc1, d2jizc2, d2jizc3, d2jizd1, d2jizd2, d2jizd3, d2jize1, d2jize2, d2jize3, d2jizf1, d2jizf2, d2jizf3, d2jizg_, d2jizh1, d2jizh2, d2jizh3, d2jizi1, d2jizi2, d2jizi3, d2jizk1, d2jizk2, d2jizk3, d2jizl1, d2jizl2, d2jizl3, d2jizm1, d2jizm2, d2jizm3, d2jizn_ |