Lineage for d2jiza2 (2jiz A:95-379)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1848393Protein automated matches [190393] (10 species)
    not a true protein
  7. 1848444Species Cow (Bos taurus) [TaxId:9913] [255271] (6 PDB entries)
  8. 1848448Domain d2jiza2: 2jiz A:95-379 [238705]
    Other proteins in same PDB: d2jiza1, d2jiza3, d2jizb1, d2jizb3, d2jizc1, d2jizc3, d2jizd1, d2jizd2, d2jizd3, d2jize1, d2jize2, d2jize3, d2jizf1, d2jizf2, d2jizf3, d2jizg_, d2jizh1, d2jizh3, d2jizi1, d2jizi3, d2jizj1, d2jizj3, d2jizk1, d2jizk2, d2jizk3, d2jizl1, d2jizl2, d2jizl3, d2jizm1, d2jizm2, d2jizm3, d2jizn_
    automated match to d1maba3
    complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jiza2

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (A:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2jiza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jiza2 c.37.1.11 (A:95-379) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d2jiza2:

Click to download the PDB-style file with coordinates for d2jiza2.
(The format of our PDB-style files is described here.)

Timeline for d2jiza2: