SCOPe 2.08: Domain d2jebi2: 2jeb I:66-152

Lineage for d2jebi2 (2jeb I:66-152)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.11: DNA replication initiator (cdc21/cdc54) N-terminal domain [89332] (2 proteins)

6. Protein DNA replication initiator (cdc21/cdc54) N-terminal domain [89333] (3 species)
   MCM complex protein; dodecamer assembly; includes the N-terminal all-alpha subdomain and inserted Zn-finger

7. Species Sulfolobus solfataricus [TaxId:2287] [419291] (4 PDB entries)

8. Domain d2jebi2: 2jeb I:66-152 [238703]
   Other proteins in same PDB: d2jeba1, d2jeba2, d2jeba3, d2jebb1, d2jebb2, d2jebi1
   automated match to d2je6i1
   complexed with 1pe, cl, mn

Details for d2jebi2

PDB Entry: 2jeb, 2.4 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to mn ions

PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2jebi2:

Sequence, based on SEQRES records:

>d2jebi2 b.40.4.11 (I:66-152) DNA replication initiator (cdc21/cdc54) N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfdrsidpvlsvkgkdlgrvs

Sequence, based on observed residues (ATOM records):

>d2jebi2 b.40.4.11 (I:66-152) DNA replication initiator (cdc21/cdc54) N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfddpvlsvkgkdlgrvs

Timeline for d2jebi2:

• d2jebi2 first appeared in SCOPe 2.04
  
• d2jebi2 appears in SCOPe 2.07