Class b: All beta proteins [48724] (176 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.0: automated matches [254239] (1 protein) not a true family |
Protein automated matches [254547] (1 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255254] (2 PDB entries) |
Domain d2jebi1: 2jeb I:8-65 [238702] Other proteins in same PDB: d2jeba1, d2jeba2, d2jebb1, d2jebb2, d2jebi2 automated match to d2je6i2 complexed with 1pe, cl, mn |
PDB Entry: 2jeb (more details), 2.4 Å
SCOPe Domain Sequences for d2jebi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jebi1 b.84.4.0 (I:8-65) automated matches {Sulfolobus solfataricus [TaxId: 2287]} kivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg
Timeline for d2jebi1:
View in 3D Domains from other chains: (mouse over for more information) d2jeba1, d2jeba2, d2jebb1, d2jebb2 |