SCOPe 2.05: Domain d2j5wa6: 2j5w A:193-338

Lineage for d2j5wa6 (2j5w A:193-338)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188940] (24 PDB entries)

8. Domain d2j5wa6: 2j5w A:193-338 [238699]
   automated match to d1kcwa2
   complexed with ca, cu, gol, na, nag, o, oxy

Details for d2j5wa6

PDB Entry: 2j5w, 2.8 Å

PDB Description: ceruloplasmin revisited: structural and functional roles of various metal cation binding sites

PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d2j5wa6:

Sequence; same for both SEQRES and ATOM records:

>d2j5wa6 b.6.1.0 (A:193-338) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqqsnrmysvngytfgsls
glsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpatlfdaymvaqnp
gewmlscqnlnhlkaglqaffqvqec

Timeline for d2j5wa6:

• d2j5wa6 first appeared in SCOPe 2.04
  
• d2j5wa6 appears in SCOPe 2.06
  
• d2j5wa6 appears in the current release, SCOPe 2.08