SCOPe 2.06: Domain d2j3zf2: 2j3z F:218-426

Lineage for d2j3zf2 (2j3z F:218-426)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [230888] (3 PDB entries)

8. Domain d2j3zf2: 2j3z F:218-426 [238698]
   automated match to d2j3za2
   complexed with co, gol, so4

Details for d2j3zf2

PDB Entry: 2j3z, 2.3 Å

PDB Description: crystal structure of the enzymatic component c2-i of the c2-toxin from clostridium botulinum at ph 6.1

PDB Compounds: (F:) c2 toxin component I

SCOPe Domain Sequences for d2j3zf2:

Sequence; same for both SEQRES and ATOM records:

>d2j3zf2 d.166.1.0 (F:218-426) automated matches {Clostridium botulinum [TaxId: 1491]}
eldfynkgseawgaenygdyisklsheqlgalegylhsdykainsylrnnrvpnndelnk
kielissalsvkpipqtliayrrvdgipfdlpsdfsfdkkengeiiadkqklnefidkwt
gkeienlsfsstslkstpssfsksrfifrlrlsegaigafiygfsgfqdeqeillnknst
fkifritpitsiinrvtkmtqvvidaegi

Timeline for d2j3zf2:

• d2j3zf2 first appeared in SCOPe 2.04
  
• d2j3zf2 appears in SCOPe 2.05
  
• d2j3zf2 appears in SCOPe 2.07
  
• d2j3zf2 appears in the current release, SCOPe 2.08