Lineage for d2j3zf1 (2j3z F:6-217)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234153Species Clostridium botulinum [TaxId:1491] [230888] (3 PDB entries)
  8. 2234167Domain d2j3zf1: 2j3z F:6-217 [238697]
    automated match to d2j3za1
    complexed with co, gol, so4

Details for d2j3zf1

PDB Entry: 2j3z (more details), 2.3 Å

PDB Description: crystal structure of the enzymatic component c2-i of the c2-toxin from clostridium botulinum at ph 6.1
PDB Compounds: (F:) c2 toxin component I

SCOPe Domain Sequences for d2j3zf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j3zf1 d.166.1.0 (F:6-217) automated matches {Clostridium botulinum [TaxId: 1491]}
epidfinkpeseakkwgkeeekrwftklnnleevavnqlknkeyktkidnfstdilfssl
taieimkedenrnlfdverireallkntldrdaigyvnftpkelginfsirdveldrdis
detldkvrqqiinqeytkfsfislglndnsinesvpvivktrvpttfdygvlndketvsl
llnqgfsiipesaiittikgkdyiliegslsq

SCOPe Domain Coordinates for d2j3zf1:

Click to download the PDB-style file with coordinates for d2j3zf1.
(The format of our PDB-style files is described here.)

Timeline for d2j3zf1: