![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.384: SV5-V core-like [254114] (1 superfamily) 3 layers; central antiparallel beta sheet has 1432 topology; two loops comprise zinc finger motif |
![]() | Superfamily d.384.1: SV5-V core-like [254136] (1 family) ![]() PubMed 16413485; combines Pfam PF14313 and Pfam PF13008 |
![]() | Family d.384.1.1: SV5-V core-like [254178] (1 protein) |
![]() | Protein SV5-V core [254398] (1 species) |
![]() | Species Simian virus 5 [TaxId:11207] [254834] (2 PDB entries) |
![]() | Domain d2hyeb_: 2hye B: [238680] Other proteins in same PDB: d2hyec1, d2hyec2, d2hyec3, d2hyed_ automated match to d2b5ld_ complexed with zn |
PDB Entry: 2hye (more details), 3.1 Å
SCOPe Domain Sequences for d2hyeb_:
Sequence, based on SEQRES records: (download)
>d2hyeb_ d.384.1.1 (B:) SV5-V core {Simian virus 5 [TaxId: 11207]} pdeinklietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiqestnhqkgs vgggakpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgktlpsgsykg vklakfgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwvgdevkvtew cnpscspitaaarrfectchqcpvtcsecerdt
>d2hyeb_ d.384.1.1 (B:) SV5-V core {Simian virus 5 [TaxId: 11207]} pdeinklietglntveyftsqqvtgtsslgkntippgvtglltnapkiaivpaddktvpg kpipnpllgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieeprenpdfk rgrdtggfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
Timeline for d2hyeb_:
![]() Domains from other chains: (mouse over for more information) d2hyec1, d2hyec2, d2hyec3, d2hyed_ |