SCOPe 2.07: Domain d2hyeb_: 2hye B:

Lineage for d2hyeb_ (2hye B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.384: SV5-V core-like [254114] (1 superfamily)
   3 layers; central antiparallel beta sheet has 1432 topology; two loops comprise zinc finger motif

4. Superfamily d.384.1: SV5-V core-like [254136] (1 family)
   PubMed 16413485; combines Pfam PF14313 and Pfam PF13008

5. Family d.384.1.1: SV5-V core-like [254178] (1 protein)

6. Protein SV5-V core [254398] (1 species)

7. Species Simian virus 5 [TaxId:11207] [254834] (2 PDB entries)

8. Domain d2hyeb_: 2hye B: [238680]
   Other proteins in same PDB: d2hyec1, d2hyec2, d2hyec3, d2hyed_
   automated match to d2b5ld_
   complexed with zn

Details for d2hyeb_

PDB Entry: 2hye, 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex

PDB Compounds: (B:) Nonstructural protein V

SCOPe Domain Sequences for d2hyeb_:

Sequence, based on SEQRES records:

>d2hyeb_ d.384.1.1 (B:) SV5-V core {Simian virus 5 [TaxId: 11207]}
pdeinklietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiqestnhqkgs
vgggakpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgktlpsgsykg
vklakfgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwvgdevkvtew
cnpscspitaaarrfectchqcpvtcsecerdt

Sequence, based on observed residues (ATOM records):

>d2hyeb_ d.384.1.1 (B:) SV5-V core {Simian virus 5 [TaxId: 11207]}
pdeinklietglntveyftsqqvtgtsslgkntippgvtglltnapkiaivpaddktvpg
kpipnpllgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieeprenpdfk
rgrdtggfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt

Timeline for d2hyeb_:

• d2hyeb_ first appeared in SCOPe 2.04
  
• d2hyeb_ appears in SCOPe 2.06
  
• d2hyeb_ appears in the current release, SCOPe 2.08