Lineage for d2hldx3 (2hld X:358-475)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739159Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1739160Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1739288Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1739289Protein automated matches [254528] (7 species)
    not a true protein
  7. 1739297Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)
  8. 1739312Domain d2hldx3: 2hld X:358-475 [238679]
    Other proteins in same PDB: d2hldd1, d2hldd2, d2hlde1, d2hlde2, d2hldf1, d2hldf2, d2hldg_, d2hldm1, d2hldm2, d2hldn1, d2hldn2, d2hldo1, d2hldo2, d2hldp_, d2hldv1, d2hldv2, d2hldw1, d2hldw2, d2hldx1, d2hldx2, d2hldy_
    automated match to d2jdid1
    complexed with anp, mg, po4

Details for d2hldx3

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (X:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2hldx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hldx3 a.69.1.0 (X:358-475) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

SCOPe Domain Coordinates for d2hldx3:

Click to download the PDB-style file with coordinates for d2hldx3.
(The format of our PDB-style files is described here.)

Timeline for d2hldx3: