Class a: All alpha proteins [46456] (286 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries) |
Domain d2hldv3: 2hld V:358-475 [238673] Other proteins in same PDB: d2hldd1, d2hldd2, d2hlde1, d2hlde2, d2hldf1, d2hldf2, d2hldg_, d2hldm1, d2hldm2, d2hldn1, d2hldn2, d2hldo1, d2hldo2, d2hldp_, d2hldv1, d2hldv2, d2hldw1, d2hldw2, d2hldx1, d2hldx2, d2hldy_ automated match to d2jdid1 complexed with anp, mg, po4 |
PDB Entry: 2hld (more details), 2.8 Å
SCOPe Domain Sequences for d2hldv3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hldv3 a.69.1.0 (V:358-475) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
Timeline for d2hldv3:
View in 3D Domains from other chains: (mouse over for more information) d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_ |