SCOPe 2.05: Domain d2hldv1: 2hld V:6-82

Lineage for d2hldv1 (2hld V:6-82)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (7 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)

8. Domain d2hldv1: 2hld V:6-82 [238671]
   Other proteins in same PDB: d2hldd2, d2hldd3, d2hlde2, d2hlde3, d2hldf2, d2hldf3, d2hldg_, d2hldm2, d2hldm3, d2hldn2, d2hldn3, d2hldo2, d2hldo3, d2hldp_, d2hldv2, d2hldv3, d2hldw2, d2hldw3, d2hldx2, d2hldx3, d2hldy_
   automated match to d2jdid2
   complexed with anp, mg, po4

Details for d2hldv1

PDB Entry: 2hld, 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase

PDB Compounds: (V:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2hldv1:

Sequence; same for both SEQRES and ATOM records:

>d2hldv1 b.49.1.0 (V:6-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
gteglvrgekvldtggp

Timeline for d2hldv1:

• d2hldv1 first appeared in SCOPe 2.04
  
• d2hldv1 appears in SCOPe 2.06
  
• d2hldv1 appears in the current release, SCOPe 2.08