SCOP 1.73: Domain d1tnra_: 1tnr A:

Lineage for d1tnra_ (1tnr A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (1 family)

5. Family b.22.1.1: TNF-like [49843] (13 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (7 PDB entries)

8. Domain d1tnra_: 1tnr A: [23867]
   Other proteins in same PDB: d1tnrr1, d1tnrr2, d1tnrr3

Details for d1tnra_

PDB Entry: 1tnr, 2.85 Å

PDB Description: crystal structure of the soluble human 55 kd tnf receptor-human tnf- beta complex: implications for tnf receptor activation

PDB Compounds: (A:) tumor necrosis factor beta

SCOP Domain Sequences for d1tnra_:

Sequence; same for both SEQRES and ATOM records:

>d1tnra_ b.22.1.1 (A:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
kpaahligdpskqnsllwrantdraflqdgfslsnnsllvptsgiyfvysqvvfsgkays
pkatssplylahevqlfssqypfhvpllssqkmvypglqepwlhsmyhgaafqltqgdql
sthtdgiphlvlspstvffgafal

Timeline for d1tnra_:

• d1tnra_ first appeared (with stable ids) in SCOP 1.55
  
• d1tnra_ appears in SCOP 1.71
  
• d1tnra_ appears in SCOP 1.75
  
• d1tnra_ appears in the current release, SCOPe 2.08