![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
![]() | Protein automated matches [254527] (6 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries) |
![]() | Domain d2hldn1: 2hld N:6-82 [238665] Other proteins in same PDB: d2hldd2, d2hldd3, d2hlde2, d2hlde3, d2hldf2, d2hldf3, d2hldg_, d2hldm2, d2hldm3, d2hldn2, d2hldn3, d2hldo2, d2hldo3, d2hldp_, d2hldv2, d2hldv3, d2hldw2, d2hldw3, d2hldx2, d2hldx3, d2hldy_ automated match to d2jdid2 complexed with anp, mg, po4 |
PDB Entry: 2hld (more details), 2.8 Å
SCOPe Domain Sequences for d2hldn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hldn1 b.49.1.0 (N:6-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd gteglvrgekvldtggp
Timeline for d2hldn1:
![]() Domains from other chains: (mouse over for more information) d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldm1, d2hldm2, d2hldm3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_ |