SCOPe 2.04: Domain d2hldd3: 2hld D:358-475

Lineage for d2hldd3 (2hld D:358-475)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)

8. Domain d2hldd3: 2hld D:358-475 [238655]
   Other proteins in same PDB: d2hldd1, d2hldd2, d2hlde1, d2hlde2, d2hldf1, d2hldf2, d2hldg_, d2hldm1, d2hldm2, d2hldn1, d2hldn2, d2hldo1, d2hldo2, d2hldp_, d2hldv1, d2hldv2, d2hldw1, d2hldw2, d2hldx1, d2hldx2, d2hldy_
   automated match to d2jdid1
   complexed with anp, mg, po4

Details for d2hldd3

PDB Entry: 2hld, 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase

PDB Compounds: (D:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2hldd3:

Sequence; same for both SEQRES and ATOM records:

>d2hldd3 a.69.1.0 (D:358-475) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

Timeline for d2hldd3:

• d2hldd3 is new in SCOPe 2.04-stable
  
• d2hldd3 appears in SCOPe 2.05
  
• d2hldd3 appears in the current release, SCOPe 2.08