![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein automated matches [190393] (10 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries) |
![]() | Domain d2hldd2: 2hld D:83-357 [238654] Other proteins in same PDB: d2hldd1, d2hldd3, d2hlde1, d2hlde3, d2hldf1, d2hldf3, d2hldg_, d2hldm1, d2hldm3, d2hldn1, d2hldn3, d2hldo1, d2hldo3, d2hldp_, d2hldv1, d2hldv3, d2hldw1, d2hldw3, d2hldx1, d2hldx3, d2hldy_ automated match to d2jdid3 complexed with anp, mg, po4 |
PDB Entry: 2hld (more details), 2.8 Å
SCOPe Domain Sequences for d2hldd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hldd2 c.37.1.11 (D:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap attfahldattvlsrgiselgiypavdpldsksrl
Timeline for d2hldd2:
![]() Domains from other chains: (mouse over for more information) d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_ |